TEX44 Antibody - BSA Free NBP2-49226 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

TEX44 Antibody

Immunohistochemistry-Paraffin: TEX44 Antibody [NBP2-49226] - C2orf57 Antibody [NBP2-49226] - Staining in human testis and kidney tissues using anti-TEX44 antibody. Corresponding TEX44 RNA-seq data are presented for the same tissues.
TEX44 Antibody

TEX44 Antibody
TEX44 Antibody

Immunohistochemistry-Paraffin: TEX44 Antibody [NBP2-49226] - C2orf57 Antibody [NBP2-49226] - Staining in human testis and kidney tissues using anti-TEX44 antibody. Corresponding TEX44 RNA-seq data are presented for the same tissues.
TEX44 Antibody

Immunohistochemistry-Paraffin: TEX44 Antibody [NBP2-49226] - C2orf57 Antibody [NBP2-49226] - Staining in human testis and kidney tissues using anti-TEX44 antibody. Corresponding TEX44 RNA-seq data are presented for the same tissues.
TEX44 Antibody

Immunohistochemistry-Paraffin: TEX44 Antibody [NBP2-49226] - C2orf57 Antibody [NBP2-49226] - Staining in human testis and kidney tissues using anti-TEX44 antibody. Corresponding TEX44 RNA-seq data are presented for the same tissues.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
TEX44 Antibody - BSA Free

Product Specs
ItemTEX44 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-49226
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetTEX44
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: SHLLGKDKMS QMASVPEREP ESAPSAPSAE LQSTQHMEAQ PVESDADHVT AGANGQHGPQ AASTTKSAEE KAEHP
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nametestis expressed 44
NCBI Gene AliasesC2orf57

Sequence

SHLLGKDKMSQMASVPEREPESAPSAPSAELQSTQHMEAQPVESDADHVTAGANGQHGPQAASTTKSAEEKAEHP

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!