TBP like protein TLP Antibody - BSA Free NBP2-49671 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

TBP like protein TLP Antibody

Immunocytochemistry/Immunofluorescence: TBP like protein TLP Antibody [NBP2-49671] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
TBP like protein TLP Antibody

TBP like protein TLP Antibody
TBP like protein TLP Antibody

Immunocytochemistry/Immunofluorescence: TBP like protein TLP Antibody [NBP2-49671] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
TBP like protein TLP Antibody

Immunocytochemistry/Immunofluorescence: TBP like protein TLP Antibody [NBP2-49671] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
TBP like protein TLP Antibody

Immunocytochemistry/Immunofluorescence: TBP like protein TLP Antibody [NBP2-49671] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
TBP like protein TLP Antibody - BSA Free

Product Specs
ItemTBP like protein TLP Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-49671
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetTBP like protein TLP
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: DADSDVALDI LITNVVCVFR TRCHLNLRKI ALEGANVIYK RDVGKVLMKL RKPRITATIW SSGKIICTGA TSEEEAKFGA RR
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
Research AreaNeurodegeneration, Neuroscience
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameTATA-box binding protein like 1
NCBI Gene AliasesMGC:8389, MGC:9620, STUD, TLF, TLP, TRF2

Sequence

DADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARR

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!