UBA3 Antibody - BSA Free NBP2-48628 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

UBA3 Antibody

Western Blot: UBA3 Antibody [NBP2-48628]
UBA3 Antibody

UBA3 Antibody
UBA3 Antibody

Western Blot: UBA3 Antibody [NBP2-48628] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG
UBA3 Antibody

Western Blot: UBA3 Antibody [NBP2-48628] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG
UBA3 Antibody

Western Blot: UBA3 Antibody [NBP2-48628] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG

Be the first to write a review!

Citations:

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
UBA3 Antibody - BSA Free

Product Specs
ItemUBA3 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP2-48628
Quantity0.1 ml
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetUBA3
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: YPPQVNFPMC TIASMPRLPE HCIEYVRMLQ WPKEQPFGEG VPLDGDDPEH IQWIFQKSLE RASQYNIRGV TYRLTQGVVK RIIPAVASTN AVIAAVCA
ClonalityPolyclonal
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameubiquitin like modifier activating enzyme 3
NCBI Gene AliasesNAE2, UBE1C, hUBA3
Research AreaApoptosis, Cell Cycle and Replication, Neuroscience
PurityAffinity purified

Sequence

YPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCA

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) DCUN1D1 Is an Essential Regulator of Prostate Cancer Proliferation and Tumour Growth That Acts through Neddylation of Cullin 1, 3, 4A and 5 and Deregulation of Wnt/Catenin PathwayCellsJuly 31, 2023Vava A, Paccez JD, Wang Y, Gu X, Bhasin MK, Myers M, Soares NC, Libermann TA, Zerbini LF.(Novus Biologicals NBP1-22970), APPBP1 (Cell Signaling Technology CST14321), UBA3 (Novus Biologicals NBP2-48628), UBC12 (Novus Biologicals NBP1-31459), CAND1 (Cell Signaling Technology CST8759S), RBX1 (Novus Biologicals

Be the First to Write a Review!