IBA57 Antibody - BSA Free NBP2-48594 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

IBA57 Antibody

Western Blot: IBA57 Antibody [NBP2-48594]
IBA57 Antibody

IBA57 Antibody
IBA57 Antibody

Western Blot: C1orf69 Antibody [NBP2-48594] - Analysis in control (vector only transfected HEK293T lysate) and IBA57 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
IBA57 Antibody

Western Blot: C1orf69 Antibody [NBP2-48594] - Analysis in control (vector only transfected HEK293T lysate) and IBA57 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
IBA57 Antibody - BSA Free

Product Specs
ItemIBA57 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP2-48594
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Gene AliasesC1orf69, MMDS3, SPG74
NCBI Full Gene Nameiron-sulfur cluster assembly factor IBA57
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsWB, IHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: FPVRFLDPLP TSGITPGATV LTASGQTVGK FRAGQGNVGL ALLWSEKIKG PLHIRASEGA QVALAASVPD WWPTVSK
HostRabbit
IsotypeIgG
TargetIBA57
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml

Specifications/Features

Available conjugates: Unconjugated

Sequence

FPVRFLDPLPTSGITPGATVLTASGQTVGKFRAGQGNVGLALLWSEKIKGPLHIRASEGAQVALAASVPDWWPTVSK

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!