Coactosin-like Protein 1/CotL1 Antibody - BSA Free NBP2-48515 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Coactosin-like Protein 1/CotL1 Antibody

Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP2-48515] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue
Coactosin-like Protein 1/CotL1 Antibody

Coactosin-like Protein 1/CotL1 Antibody
Coactosin-like Protein 1/CotL1 Antibody

Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP2-48515] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue
Coactosin-like Protein 1/CotL1 Antibody

Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP2-48515] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue
Coactosin-like Protein 1/CotL1 Antibody

Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP2-48515] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Coactosin-like Protein 1/CotL1 Antibody - BSA Free

Product Specs
ItemCoactosin-like Protein 1/CotL1 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP2-48515
Quantity0.1 ml
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
PurityAffinity purified
TargetCoactosin-like Protein 1/CotL1
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: IWVTFKYDGS TIVPGEQGAE YQHFIQQCTD DVRLFAFVRF TTGDAMSKRS KFALITWIGE NVSGLQRAKT GTDKTLVKEV VQNFAKEFVI SDRKEL
Antibody TypePrimary Antibodies
ClonalityPolyclonal
Research AreaCytokine Research, Signal Transduction
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namecoactosin like F-actin binding protein 1
NCBI Gene AliasesCLP

Specifications/Features

Available conjugates: Unconjugated

Sequence

IWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!