DNAH2 Antibody

Product Specs
ItemDNAH2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-49506
Quantity0.1 ml (also 25 ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetDNAH2
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: PGEWENACNE MQRMLIVRSL RQDRVAFCVT SFIITNLGSR FIEPPVLNMK SVLEDSTPRS PLVFILSPGV DPTSALL
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namedynein axonemal heavy chain 2
NCBI Gene AliasesDNAHC2, DNHD3, SPGF45

Sequence

PGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALL

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) ZMYND12 serves as an IDAd subunit that is essential for sperm motility in miceCellular and molecular life sciences : CMLSJuly 27, 2024Wang C, Xie Q, Xia X, Zhang C, Jiang S, Wang S, Zhang X, Hua R, Xue J, Zheng H.FNab00082), anti-DNAH1 used for IF (Thermo Fisher Scientific, PA5-57826), anti-DNAH2 used for IF (Novus, NBP2-49506), anti-DNAH10 used for IF (Bioss, bs-11022R), anti-DNAH12 used for IF (Thermo Fisher Scientific, PA5-63952),

(2) Bi-allelic variants in DNAH3 cause male infertility with asthenoteratozoospermia in humans and miceHuman reproduction openJanuary 1, 2024Meng GQ, Wang Y, Luo C, Tan YM, Li Y, Tan C, Tu C, Zhang QJ, Hu L, Zhang H, et al.Biotechnology Co. Ltd, customized, 1:300, Shanghai, China), rabbit polyclonal anti-DNAH2 (Novus Biologicals, NBP2-49506, 1:500, Littleton, CO, USA), rabbit polyclonal anti-DNAH6 (Abcam, ab122333, 1:500, Cambridge, MA, USA),

(3) Bi-allelic variants in DNHD1 cause flagellar axoneme defects and asthenoteratozoospermia in humans and miceAmerican journal of human geneticsJanuary 6, 2022Tan C, Meng L, Lv M, He X, Sha Y, Tang D, Tan Y, Hu T, He W, Tu C, et al.

(4) Novel bi-allelic variants in DNAH2 cause severe asthenoteratozoospermia with multiple morphological abnormalities of the flagellaReproductive biomedicine onlineMay 1, 2021Gao Y, Tian S, Sha Y, Zha X, Cheng H, Wang A, Liu C, Lv M, Ni X, Li Q, et al.

(5) DNAH2 is a novel candidate gene associated with multiple morphological abnormalities of the sperm flagellaClinical geneticsMay 1, 2019Li Y, Sha Y, Wang X, Ding L, Liu W, Ji Z, Mei L, Huang X, Lin S, Kong S, et al.

Be the First to Write a Review!

DNAH2 Antibody

DNAH2 Antibody

DNAH2 Antibody

DNAH2 Antibody

DNAH2 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

Sequence

Specifications/Features

Novus Biologicals, a Bio-Techne Brand

Citations (5)

Reviews

DNAH2 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map