Fumarylacetoacetate hydrolase Antibody - BSA Free NBP2-48736 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Fumarylacetoacetate hydrolase Antibody

Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48736] - Staining in human liver and pancreas tissues using anti-FAH antibody. Corresponding FAH RNA-seq data are presented for the same tissues.
Fumarylacetoacetate hydrolase Antibody

Fumarylacetoacetate hydrolase Antibody
Fumarylacetoacetate hydrolase Antibody

Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48736] - Staining in human liver and pancreas tissues using anti-FAH antibody. Corresponding FAH RNA-seq data are presented for the same tissues.
Fumarylacetoacetate hydrolase Antibody

Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48736] - Staining in human liver and pancreas tissues using anti-FAH antibody. Corresponding FAH RNA-seq data are presented for the same tissues.
Fumarylacetoacetate hydrolase Antibody

Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48736] - Staining in human liver and pancreas tissues using anti-FAH antibody. Corresponding FAH RNA-seq data are presented for the same tissues.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Fumarylacetoacetate hydrolase Antibody - BSA Free

Product Specs
ItemFumarylacetoacetate hydrolase Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $559.00Supplier Page View Company Product Page
Catalog NumberNBP2-48736
Antibody TypePrimary Antibodies
NCBI Full Gene Namefumarylacetoacetate hydrolase
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Research AreaLipid and Metabolism
PurityAffinity purified
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsWB, ICC, IF, IHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: INLSVNLKGE GMSQAATICK SNFKYMYWTM LQQLTHHSVN GCNLRPGDLL ASGTISGPEP ENFGSMLELS WKGTKPIDLG NGQTRKFLLD GD
HostRabbit
IsotypeIgG
TargetFumarylacetoacetate hydrolase
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)

Specifications/Features

Available conjugates: Unconjugated

Sequence

INLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGD

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!