RNF170 Antibody - BSA Free NBP2-48986 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

RNF170 Antibody

Western Blot: RNF170 Antibody [NBP2-48986]
RNF170 Antibody

RNF170 Antibody
RNF170 Antibody

Western Blot: RNF170 Antibody [NBP2-48986] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp
RNF170 Antibody

Western Blot: RNF170 Antibody [NBP2-48986] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
RNF170 Antibody - BSA Free

Product Specs
ItemRNF170 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-48986
NCBI Gene AliasesADSA, SNAX1, SPG85
NCBI Full Gene Namering finger protein 170
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Antibody TypePrimary Antibodies
Research AreaZinc Finger
PurityAffinity purified
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsWB, IHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: CGACIIAYWR YGSWLGAISC PICRQTVTLL LTVFGEDDQS QDVLRLHQDI NDYNRRFSGQ PRSIMERIMD LPT
HostRabbit
IsotypeIgG
TargetRNF170
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)

Specifications/Features

Available conjugates: Unconjugated

Sequence

CGACIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPT

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!