Ferroportin/SLC40A1 Antibody - BSA Free NBP2-49454 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Ferroportin/SLC40A1 Antibody

Immunocytochemistry/Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Ferroportin/SLC40A1 Antibody staining is shown in green.
Ferroportin/SLC40A1 Antibody

Ferroportin/SLC40A1 Antibody
Ferroportin/SLC40A1 Antibody

Immunocytochemistry/Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Ferroportin/SLC40A1 Antibody staining is shown in green.
Ferroportin/SLC40A1 Antibody

Immunocytochemistry/Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Ferroportin/SLC40A1 Antibody staining is shown in green.
Ferroportin/SLC40A1 Antibody

Immunocytochemistry/Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Ferroportin/SLC40A1 Antibody staining is shown in green.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Ferroportin/SLC40A1 Antibody - BSA Free

Product Specs
ItemFerroportin/SLC40A1 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $559.00Supplier Page View Company Product Page
Catalog NumberNBP2-49454
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetFerroportin/SLC40A1
IsotypeIgG
HostRabbit
ImmunogenThis Ferroportin/SLC40A1 Antibody was developed against a recombinant protein corresponding to amino acids: VKAGLKEEET ELKQLNLHKD TEPKPLEGTH LMGVKDSNIH ELEHEQEPTC ASQMAEPFRT FRDGWVSYYN
ClonalityPolyclonal
PurityAffinity purified
Research AreaCancer, Lipid and Metabolism, Signal Transduction
Molecular Weight62.5 kDa
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namesolute carrier family 40 member 1
NCBI Gene AliasesFPN, FPN1, HFE4, IREG1, MST079, MSTP079, MTP1, SLC11A3

Sequence

VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!