CEP78 Antibody

Product Specs
ItemCEP78 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-48920
PurityAffinity purified
NCBI Full Gene Namecentrosomal protein 78
NCBI Gene AliasesC9orf81, CRDHL, IP63
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Antibody TypePrimary Antibodies
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsIHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: ALETNTTLVV LDIRKNPLID HSMMKAVIKK VLQNGRSAKS EYQWITSPSV KEPSKTAKQK RRTIILGSGH KGKATIRIGL ATKKPVSSGR K
HostRabbit
IsotypeIgG
TargetCEP78
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)

Available conjugates: Unconjugated

ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

(1) Centrosome Protein 78 Is Overexpressed in Muscle-Invasive Bladder Cancer and Is Associated with Tumor Molecular Subtypes and Mutation SignaturesMedical science monitor : international medical journal of experimental and clinical researchOctober 29, 2020Huang X, Yan Y, Wei R, Liu H, Zhu X, Bi D, Wei Q, Yao X.a BenchMark ULTRA automated immunohistochemical staining system (Roche) with the CEP78 antibody (1: 200; NBP248920, Novus). The percentage of stained cells (0 for 0%, 1 for 1–10%, 2 for 11–25%, 3 for 26–50%, 4 for 51–75%,

CEP78 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand