VMAT1 (SLC18A1) Rabbit Polyclonal Antibody TA339066 from OriGene Technologies | Biocompare.com

Supplier Images

VMAT1 (SLC18A1) Rabbit Polyclonal Antibody

WB Suggested Anti-SLC18A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
VMAT1 (SLC18A1) Rabbit Polyclonal Antibody

The VMAT1 (SLC18A1) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to SLC18A1. This antibody recognizes Homo Sapiens, and Human antigen. The VMAT1 (SLC18A1) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-SLC18A1 Antibody

Product Specs
ItemVMAT1 (SLC18A1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339066
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetVMAT1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-SLC18A1 antibody: synthetic peptide directed towards the N terminal of human SLC18A1. Synthetic peptide located within the following region: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLL
NCBI Full Gene Namesolute carrier family 18 member A1
NCBI Gene AliasesCGAT, VAT1, VMAT1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!