CHI3L1 Rabbit Polyclonal Antibody TA340002 from OriGene Technologies | Biocompare.com

Supplier Images

CHI3L1 Rabbit Polyclonal Antibody

WB Suggested Anti-CHI3L1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate
CHI3L1 Rabbit Polyclonal Antibody

simian immunodeficiency virus encephalitis

Be the first to write a review!

Supplier Page from
OriGene Technologies for
CHI3L1 Rabbit Polyclonal Antibody

The CHI3L1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, Human, and Non-Human Primate antigen. The CHI3L1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Immunocytochemistry, Immunofluorescence, and Western Blot.

Description

Rabbit Polyclonal Anti-CHI3L1 Antibody

Product Specs
ItemCHI3L1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340002
Quantity100 µl
ApplicationsIF, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman, SimianIVE
TargetCHI3L1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1. Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
NCBI Full Gene Namechitinase 3 like 1
NCBI Gene AliasesYYL-40, GP-39, ASRT7, YKL40, HC-gp39, CGP-39, GP39, YK-40, HCGP-3P, hCGP-39, YKL-40
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!