UBP43 (USP18) Rabbit Polyclonal Antibody TA339338 from OriGene Technologies | Biocompare.com

Supplier Images

UBP43 (USP18) Rabbit Polyclonal Antibody

USP18 antibody - N-terminal region validated by WB using Mouse Brain lysate at 2 ug/ml.
UBP43 (USP18) Rabbit Polyclonal Antibody

WB Suggested Anti-USP18 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Hela cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
UBP43 (USP18) Rabbit Polyclonal Antibody

OriGene Technologies' UBP43 (USP18) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The UBP43 (USP18) Rabbit Polyclonal Antibody was generated using USP18 as the antigen and it reacts with Homo Sapiens, Human, and Mouse.

Description

Rabbit Polyclonal Anti-USP18 Antibody

Product Specs
ItemUBP43 (USP18) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339338
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Mouse
TargetUBP43
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-USP18 antibody: synthetic peptide directed towards the N terminal of human USP18. Synthetic peptide located within the following region: MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH
NCBI Full Gene Nameubiquitin specific peptidase 18
NCBI Gene AliasesPTORCH2, UBP43, ISG43
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!