C13ORF28 (SPACA7) Rabbit Polyclonal Antibody TA346493 from OriGene Technologies | Biocompare.com

Supplier Images

C13ORF28 (SPACA7) Rabbit Polyclonal Antibody

WB Suggested Anti-C13orf28 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: COLO205 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C13ORF28 (SPACA7) Rabbit Polyclonal Antibody

The C13ORF28 (SPACA7) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to SPACA7. This antibody recognizes Homo Sapiens, and Human antigen. The C13ORF28 (SPACA7) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-C13orf28 Antibody

Product Specs
ItemC13ORF28 (SPACA7) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346493
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetC13ORF28
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C13orf28 antibody: synthetic peptide directed towards the middle region of human C13orf28. Synthetic peptide located within the following region: PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ
NCBI Full Gene Namesperm acrosome associated 7
NCBI Gene AliasesC13orf28
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!