Rab9 (RAB9A) Rabbit Polyclonal Antibody TA339266 from OriGene Technologies | Biocompare.com

Supplier Images

Rab9 (RAB9A) Rabbit Polyclonal Antibody

WB Suggested Anti-RAB9A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate
Rab9 (RAB9A) Rabbit Polyclonal Antibody

RAB9A antibody - middle region validated by WB using 1. Human Cervical Cancer Cell Lysate (15ug); 2. Monkey Fibroblast Cell Lysate (15ug); 3. Human Cervical Cancer Cell transfected with mouse Rab9A-GFP (15ug) at 1: 1000.

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rab9 (RAB9A) Rabbit Polyclonal Antibody

OriGene Technologies' Rab9 (RAB9A) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-RAB9A Antibody

Product Specs
ItemRab9 (RAB9A) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339266
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Monkey
TargetRab9
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RAB9A antibody: synthetic peptide directed towards the middle region of human RAB9A. Synthetic peptide located within the following region: FETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSC
NCBI Full Gene NameRAB9A, member RAS oncogene family
NCBI Gene AliasesRAB9
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!