C21orf45 (MIS18A) Rabbit Polyclonal Antibody TA338939 from OriGene Technologies | Biocompare.com

Supplier Images

C21orf45 (MIS18A) Rabbit Polyclonal Antibody

WB Suggested Anti-C21orf45 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: NCI-H226 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C21orf45 (MIS18A) Rabbit Polyclonal Antibody

OriGene Technologies' C21orf45 (MIS18A) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-C21orf45 Antibody

Product Specs
ItemC21orf45 (MIS18A) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338939
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
PurityProtein A purified
ReactivityHuman
TargetC21orf45
IsotypeIgG
HostRabbit
TypePrimary Antibodies
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C21orf45 antibody: synthetic peptide directed towards the N terminal of human C21orf45. Synthetic peptide located within the following region: MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS
NCBI Full Gene NameMIS18 kinetochore protein A
NCBI Gene AliasesB28, C21orf46, C21orf45, MIS18alpha, hMis18alpha, FASP1
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!