RRP1B Rabbit Polyclonal Antibody TA338931 from OriGene Technologies | Biocompare.com

Supplier Images

RRP1B Rabbit Polyclonal Antibody

WB Suggested Anti-RRP1B Antibody Titration: 5% Milk; ELISA Titer: dilution: 1: 500; Positive Control: human LCL
RRP1B Rabbit Polyclonal Antibody

WB Suggested Anti-RRP1B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate.RRP1B is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RRP1B Rabbit Polyclonal Antibody

OriGene Technologies' RRP1B Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The RRP1B Rabbit Polyclonal Antibody was generated using RRP1B as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-RRP1B Antibody

Product Specs
ItemRRP1B Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338931
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetRRP1B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RRP1B antibody: synthetic peptide directed towards the middle region of human RRP1B. Synthetic peptide located within the following region: VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP
NCBI Full Gene Nameribosomal RNA processing 1B
NCBI Gene AliasesPPP1R136, RRP1, KIAA0179, NNP1L, Nnp1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!