OCEL1 Rabbit Polyclonal Antibody TA339756 from OriGene Technologies | Biocompare.com

Supplier Images

OCEL1 Rabbit Polyclonal Antibody

WB Suggested Anti-OCEL1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human lung

Be the first to write a review!

Supplier Page from
OriGene Technologies for
OCEL1 Rabbit Polyclonal Antibody

The OCEL1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to OCEL1. This antibody recognizes Homo Sapiens, and Human antigen. The OCEL1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-OCEL1 Antibody

Product Specs
ItemOCEL1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339756
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetOCEL1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-OCEL1 antibody: synthetic peptide directed towards the C terminal of human OCEL1. Synthetic peptide located within the following region: VWREFEMKRMDPGFLDKQARCHYLKGKLRHLKTQIQKFDDQGDSEGSVYF
NCBI Full Gene Nameoccludin/ELL domain containing 1
NCBI Gene AliasesFWP009, S863-9
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!