GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody TA338506 from OriGene Technologies | Biocompare.com

Supplier Images

GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody

WB Suggested Anti-GABRB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Small Intestine

Be the first to write a review!

Supplier Page from
OriGene Technologies for
GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody

OriGene Technologies' GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody was generated using gamma-aminobutyric acid type A receptor subunit beta1 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-GABRB1 Antibody

Product Specs
ItemGABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338506
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetGABA A Receptor beta 1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the N terminal of human GABRB1. Synthetic peptide located within the following region: TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT
NCBI Full Gene Namegamma-aminobutyric acid type A receptor subunit beta1
NCBI Gene AliasesDEE45, EIEE45
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!