MED25 Rabbit Polyclonal Antibody TA339764 from OriGene Technologies | Biocompare.com

Supplier Images

MED25 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: MED25; Sample Tissue: OVCAR-3 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml
MED25 Rabbit Polyclonal Antibody

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Be the first to write a review!

Supplier Page from
OriGene Technologies for
MED25 Rabbit Polyclonal Antibody

OriGene Technologies' MED25 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Precipitation, ChIP, Immunoprecipitation, and Western Blot. The MED25 Rabbit Polyclonal Antibody was generated using MED25 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-MED25 Antibody

Product Specs
ItemMED25 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339764
Quantity100 µl
Applications10k-ChIP, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetMED25
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-MED25 antibody is: synthetic peptide directed towards the C-terminal region of Human MED25. Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI
NCBI Full Gene Namemediator complex subunit 25
NCBI Gene AliasesTCBAP0758, BVSYS, ACID1, PTOV2, ARC92, P78, CMT2B2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!