FAM3B Rabbit Polyclonal Antibody TA338952 from OriGene Technologies | Biocompare.com

Supplier Images

FAM3B Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: FAM3B; Sample Tissue: PANC1 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FAM3B Rabbit Polyclonal Antibody

OriGene Technologies' FAM3B Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The FAM3B Rabbit Polyclonal Antibody was generated using FAM3 metabolism regulating signaling molecule B, and FAM3B as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-FAM3B Antibody

Product Specs
ItemFAM3B Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338952
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetFAM3B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-FAM3B antibody is: synthetic peptide directed towards the middle region of Human FAM3B. Synthetic peptide located within the following region: HWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIV
NCBI Full Gene NameFAM3 metabolism regulating signaling molecule B
NCBI Gene AliasesPANDER, ORF9, PRED44, C21orf76, C21orf11, 2-21
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!