RHBDF1 Rabbit Polyclonal Antibody TA338604 from OriGene Technologies | Biocompare.com

Supplier Images

RHBDF1 Rabbit Polyclonal Antibody

WB Suggested Anti-RHBDF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate
RHBDF1 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: RHBDF1; Sample Tissue: 721_B Whole Cell; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/Lane; Gel Conce

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RHBDF1 Rabbit Polyclonal Antibody

OriGene Technologies' RHBDF1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The RHBDF1 Rabbit Polyclonal Antibody was generated using RHBDF1, and rhomboid 5 homolog 1 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-RHBDF1 Antibody

Product Specs
ItemRHBDF1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338604
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetRHBDF1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RHBDF1 antibody: synthetic peptide directed towards the N terminal of human RHBDF1. Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR
NCBI Full Gene Namerhomboid 5 homolog 1
NCBI Gene Aliasesgene-89, gene-90, EGFR-RS, Dist1, C16orf8, hDist1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!