AKR1B1 Rabbit Polyclonal Antibody TA346555 from OriGene Technologies | Biocompare.com

Supplier Images

AKR1B1 Rabbit Polyclonal Antibody

WB Suggested Anti-AKR1B1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
AKR1B1 Rabbit Polyclonal Antibody

OriGene Technologies' AKR1B1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The AKR1B1 Rabbit Polyclonal Antibody was generated using AKR1B1 as the antigen and it reacts with Homo Sapiens, Human, and Mouse.

Description

Rabbit Polyclonal Anti-AKR1B1 Antibody

Product Specs
ItemAKR1B1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346555
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse, Human
TargetAKR1B1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN
NCBI Full Gene Namealdo-keto reductase family 1 member B
NCBI Gene AliasesALR2, ADR, AR, ALDR1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!