ZNF248 Rabbit Polyclonal Antibody TA339526 from OriGene Technologies | Biocompare.com

Supplier Images

ZNF248 Rabbit Polyclonal Antibody

WB Suggested Anti-ZNF248 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
ZNF248 Rabbit Polyclonal Antibody

OriGene Technologies' ZNF248 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The ZNF248 Rabbit Polyclonal Antibody was generated using ZNF248 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-ZNF248 Antibody

Product Specs
ItemZNF248 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339526
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetZNF248
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-ZNF248 antibody: synthetic peptide directed towards the N terminal of human ZNF248. Synthetic peptide located within the following region: NKTVSVENGDRGSKTFNLGTDPVSLRNYPYKICDSCEMNLKNISGLIISK
NCBI Full Gene Namezinc finger protein 248
NCBI Gene AliasesbA162G10.3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!