Ogfod3 Rabbit Polyclonal Antibody TA338666 from OriGene Technologies | Biocompare.com

Supplier Images

Ogfod3 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: RGD1305007; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Ogfod3 Rabbit Polyclonal Antibody

OriGene Technologies' Ogfod3 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-Ogfod3 Antibody

Product Specs
ItemOgfod3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338666
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityRat
TargetOgfod3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RGD1305007 antibody is: synthetic peptide directed towards the N-terminal region of Rat RGD1305007. Synthetic peptide located within the following region: RFEGCTPRKCGRGVTDIVITREEAEQIRRIAEKGLSLGGSDGGASILDLH
NCBI Full Gene Name2-oxoglutarate and iron-dependent oxygenase domain containing 3
NCBI Gene AliasesRGD1305007
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!