NT5DC2 Rabbit Polyclonal Antibody TA339359 from OriGene Technologies | Biocompare.com

Supplier Images

NT5DC2 Rabbit Polyclonal Antibody

WB Suggested Anti-NT5DC2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate
NT5DC2 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: NT5DC2; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml
NT5DC2 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: NT5DC2; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
NT5DC2 Rabbit Polyclonal Antibody

The NT5DC2 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The NT5DC2 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-NT5DC2 Antibody

Product Specs
ItemNT5DC2 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339359
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetNT5DC2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-NT5DC2 antibody: synthetic peptide directed towards the N terminal of human NT5DC2. Synthetic peptide located within the following region: IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV
NCBI Full Gene Name5'-nucleotidase domain containing 2
ClonalityPolyclonal
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
TypePrimary Antibodies

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!