5HT3E (HTR3E) Rabbit Polyclonal Antibody TA338785 from OriGene Technologies | Biocompare.com

Supplier Images

5HT3E (HTR3E) Rabbit Polyclonal Antibody

WB Suggested Anti-HTR3E Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart
5HT3E (HTR3E) Rabbit Polyclonal Antibody

Immunofluorescence -- Dilution: 1.3ug/mL

Be the first to write a review!

Supplier Page from
OriGene Technologies for
5HT3E (HTR3E) Rabbit Polyclonal Antibody

OriGene Technologies' 5HT3E (HTR3E) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunocytochemistry, Immunofluorescence, and Western Blot.

Description

Rabbit Polyclonal Anti-HTR3E Antibody

Product Specs
Item5HT3E (HTR3E) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338785
Quantity100 µl
ApplicationsIF, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Mouse
Target5HT3E
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-HTR3E antibody: synthetic peptide directed towards the middle region of human HTR3E. Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG
NCBI Full Gene Name5-hydroxytryptamine receptor 3E
NCBI Gene Aliases5-HT3-E, 5-HT3E, 5-HT3c1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!