C1D Rabbit Polyclonal Antibody TA339698 from OriGene Technologies | Biocompare.com

Supplier Images

C1D Rabbit Polyclonal Antibody

WB Suggested Anti-C1D Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C1D Rabbit Polyclonal Antibody

OriGene Technologies' C1D Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-C1D Antibody

Product Specs
ItemC1D Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339698
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
PurityAffinity Purified
ReactivityHuman
TargetC1D
IsotypeIgG
HostRabbit
TypePrimary Antibodies
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C1D antibody: synthetic peptide directed towards the N terminal of human C1D. Synthetic peptide located within the following region: AGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLE
NCBI Full Gene NameC1D nuclear receptor corepressor
NCBI Gene AliaseshC1D, Rrp47, LRP1, SUNCOR, SUN-CoR
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!