Progesterone Receptor Rabbit Polyclonal Antibody TA329187 from OriGene Technologies | Biocompare.com

Supplier Images

Progesterone Receptor Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: PR; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Progesterone Receptor Rabbit Polyclonal Antibody

OriGene Technologies' Progesterone Receptor Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Progesterone Receptor Rabbit Polyclonal Antibody was generated using PGR, and Progesterone receptor as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal anti-PR Antibody

Product Specs
ItemProgesterone Receptor Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA329187
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetProgesterone Receptor
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-PR antibody is: synthetic peptide directed towards the N-terminal region of Human PR. Synthetic peptide located within the following region: LPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAG
NCBI Full Gene Nameprogesterone receptor
NCBI Gene AliasesNR3C3, PR
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!