E2F6 Rabbit Polyclonal Antibody TA343159 from OriGene Technologies | Biocompare.com

Supplier Images

E2F6 Rabbit Polyclonal Antibody

Host: Rabbit
Target Name: E2f6
Sample Type: Rat Thymus lysates
Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
E2F6 Rabbit Polyclonal Antibody

The E2F6 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Rat antigen.

Description

Rabbit Polyclonal Anti-E2F6 Antibody

Product Specs
ItemE2F6 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA343159
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityRat
TargetE2F6
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-E2f6 antibody is: synthetic peptide directed towards the middle region of Rat E2f6. Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL
NCBI Full Gene NameE2F transcription factor 6
NCBI Gene AliasesE2F-6
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!