DYNLL1 Rabbit Polyclonal Antibody TA339165 from OriGene Technologies | Biocompare.com

Supplier Images

DYNLL1 Rabbit Polyclonal Antibody

WB Suggested Anti-DYNLL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

Be the first to write a review!

Supplier Page from
OriGene Technologies for
DYNLL1 Rabbit Polyclonal Antibody

OriGene Technologies' DYNLL1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The DYNLL1 Rabbit Polyclonal Antibody was generated using Dynll1 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-DYNLL1

Product Specs
ItemDYNLL1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339165
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetDYNLL1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the middle region of human DYNLL1. Synthetic peptide located within the following region: EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL
NCBI Full Gene Namedynein light chain LC8-type 1
NCBI Gene AliasesLC8a, PIN, DNCLC1, LC8, DLC8, DLC1, DNCL1, hdlc1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!