KCNC1 Rabbit Polyclonal Antibody TA339437 from OriGene Technologies | Biocompare.com

Supplier Images

KCNC1 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNC1 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
KCNC1 Rabbit Polyclonal Antibody

The KCNC1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to KCNC1. This antibody recognizes Homo Sapiens, and Human antigen. The KCNC1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-KCNC1 Antibody

Product Specs
ItemKCNC1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $515.00Supplier Page View Company Product Page
Catalog NumberTA339437
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetKCNC1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-KCNC1 antibody: synthetic peptide directed towards the N terminal of human KCNC1. Synthetic peptide located within the following region: TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY
NCBI Full Gene Namepotassium voltage-gated channel subfamily C member 1
NCBI Gene AliasesKV3.1, KV4, EPM7, NGK2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!