DGCR2 Rabbit Polyclonal Antibody TA339000 from OriGene Technologies | Biocompare.com

Supplier Images

DGCR2 Rabbit Polyclonal Antibody

Lanes: Lane 1: 75, 000 rat INS1 cells; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti rabbit-HRP; Secondary Antibody Dilution: 1: 1000; Gene Name: DGCR2; Submitted by: Benedich Bracleva, VUB, Universitair Ziekenhuis Brussel;
DGCR2 Rabbit Polyclonal Antibody

WB Suggested Anti-DGCR2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Hela cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
DGCR2 Rabbit Polyclonal Antibody

OriGene Technologies' DGCR2 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The DGCR2 Rabbit Polyclonal Antibody was generated using DGCR2 as the antigen and it reacts with Homo Sapiens, Human, and Rat.

Description

Rabbit Polyclonal Anti-DGCR2 Antibody

Product Specs
ItemDGCR2 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339000
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Rat
TargetDGCR2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DGCR2 antibody: synthetic peptide directed towards the middle region of human DGCR2. Synthetic peptide located within the following region: AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP
NCBI Full Gene NameDiGeorge syndrome critical region gene 2
NCBI Gene AliasesSEZ-12, IDD, LAN, DGS-C
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!