TRPC4 Rabbit Polyclonal Antibody TA338575 from OriGene Technologies | Biocompare.com

Supplier Images

TRPC4 Rabbit Polyclonal Antibody

WB Suggested Anti-TRPC4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate
TRPC4 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: TRPC4; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml
TRPC4 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: TRPC4; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
TRPC4 Rabbit Polyclonal Antibody

OriGene Technologies' TRPC4 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-TRPC4 Antibody

Product Specs
ItemTRPC4 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338575
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetTRPC4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-TRPC4 antibody: synthetic peptide directed towards the middle region of human TRPC4. Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL
NCBI Full Gene Nametransient receptor potential cation channel subfamily C member 4
NCBI Gene AliasesHTRP-4, TRP4, HTRP4
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!