SERCA3 (ATP2A3) Rabbit Polyclonal Antibody TA339001 from OriGene Technologies | Biocompare.com

Supplier Images

SERCA3 (ATP2A3) Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: ATP2A3; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml.ATP2A3 is strongly supported by BioGPS gene expression data to be expressed in MCF7
SERCA3 (ATP2A3) Rabbit Polyclonal Antibody

WB Suggested Anti-ATP2A3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate.ATP2A3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Be the first to write a review!

Supplier Page from
OriGene Technologies for
SERCA3 (ATP2A3) Rabbit Polyclonal Antibody

The SERCA3 (ATP2A3) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The SERCA3 (ATP2A3) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-ATP2A3 Antibody

Product Specs
ItemSERCA3 (ATP2A3) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339001
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetSERCA3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS
NCBI Full Gene NameATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
NCBI Gene AliasesSERCA3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!