5730409E04Rik Rabbit Polyclonal Antibody TA338831 from OriGene Technologies | Biocompare.com

Supplier Images

5730409E04Rik Rabbit Polyclonal Antibody

WB Suggested Anti-5730409E04Rik Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Pacreas

Be the first to write a review!

Supplier Page from
OriGene Technologies for
5730409E04Rik Rabbit Polyclonal Antibody

OriGene Technologies' 5730409E04Rik Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-5730409E04Rik Antibody

Product Specs
Item5730409E04Rik Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338831
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityMouse
Target5730409E04Rik
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-5730409E04Rik antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RLALLQWIRALQHQLVDQQARLQESFDTILDNRKELIRCLQQREAPCRHQ
NCBI Full Gene NameRIKEN cDNA 5730409E04Rik gene
NCBI Gene Aliases7530403E16Rik
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!