HAX1 Rabbit Polyclonal Antibody TA340094 from OriGene Technologies | Biocompare.com

Supplier Images

HAX1 Rabbit Polyclonal Antibody

WB Suggested Anti-HAX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: COLO205 cell lysateHAX1 is supported by BioGPS gene expression data to be expressed in COLO205

Be the first to write a review!

Supplier Page from
OriGene Technologies for
HAX1 Rabbit Polyclonal Antibody

The HAX1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to HAX1. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The HAX1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-HAX1 Antibody

Product Specs
ItemHAX1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340094
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse, Human
TargetHAX1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-HAX1 antibody: synthetic peptide directed towards the middle region of human HAX1. Synthetic peptide located within the following region: LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP
NCBI Full Gene NameHCLS1 associated protein X-1
NCBI Gene AliasesHCLSBP1, HS1BP1, SCN3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!