FAM3D Rabbit Polyclonal Antibody TA340317 from OriGene Technologies | Biocompare.com

Supplier Images

FAM3D Rabbit Polyclonal Antibody

WB Suggested Anti-FAM3D Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FAM3D Rabbit Polyclonal Antibody

OriGene Technologies' FAM3D Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The FAM3D Rabbit Polyclonal Antibody was generated using FAM3 metabolism regulating signaling molecule D as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-FAM3D Antibody

Product Specs
ItemFAM3D Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340317
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
PurityAffinity Purified
ReactivityHuman
TargetFAM3D
IsotypeIgG
HostRabbit
TypePrimary Antibodies
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-FAM3D antibody: synthetic peptide directed towards the middle region of human FAM3D. Synthetic peptide located within the following region: LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP
NCBI Full Gene NameFAM3 metabolism regulating signaling molecule D
NCBI Gene AliasesOIT1, EF7
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!