FLASH (CASP8AP2) Rabbit Polyclonal Antibody TA339709 from OriGene Technologies | Biocompare.com

Supplier Images

FLASH (CASP8AP2) Rabbit Polyclonal Antibody

WB Suggested Anti-CASP8AP2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FLASH (CASP8AP2) Rabbit Polyclonal Antibody

The FLASH (CASP8AP2) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to CASP8AP2. This antibody recognizes Homo Sapiens, and Human antigen. The FLASH (CASP8AP2) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-CASP8AP2 Antibody

Product Specs
ItemFLASH (CASP8AP2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339709
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetFLASH
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-CASP8AP2 antibody: synthetic peptide directed towards the N terminal of human CASP8AP2. Synthetic peptide located within the following region: SLKKNISALIKTARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTV
NCBI Full Gene Namecaspase 8 associated protein 2
NCBI Gene AliasesFLASH, CED-4, RIP25
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!