HMG4 (HMGB3) Rabbit Polyclonal Antibody TA339108 from OriGene Technologies | Biocompare.com

Supplier Images

HMG4 (HMGB3) Rabbit Polyclonal Antibody

WB Suggested Anti-HMGB3 Antibody Titration: 0.3 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta
HMG4 (HMGB3) Rabbit Polyclonal Antibody

Human Intestine

Be the first to write a review!

Supplier Page from
OriGene Technologies for
HMG4 (HMGB3) Rabbit Polyclonal Antibody

OriGene Technologies' HMG4 (HMGB3) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot. The HMG4 (HMGB3) Rabbit Polyclonal Antibody was generated using HMGB3 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-HMGB3 Antibody

Product Specs
ItemHMG4 (HMGB3) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA339108
Quantity100 µl
ApplicationsIHC, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetHMG4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-HMGB3 antibody: synthetic peptide directed towards the C terminal of human HMGB3. Synthetic peptide located within the following region: NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEE
NCBI Full Gene Namehigh mobility group box 3
NCBI Gene AliasesHMG-2a, HMG4, HMG2A, HMG-4
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!