Ftsj3 Rabbit Polyclonal Antibody TA346787 from OriGene Technologies | Biocompare.com

Supplier Images

Ftsj3 Rabbit Polyclonal Antibody

WB Suggested Anti-Ftsj3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Rat Heart

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Ftsj3 Rabbit Polyclonal Antibody

The Ftsj3 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to FtsJ RNA 2'-O-methyltransferase 3, and FTSJ3. This antibody recognizes Rat antigen. The Ftsj3 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Ftsj3 Antibody

Product Specs
ItemFtsj3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346787
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityRat
TargetFtsj3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Ftsj3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: QVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQRKEQKRNHRRK
NCBI Full Gene NameFtsJ RNA 2'-O-methyltransferase 3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!