Pyrophosphatase 1 (PPA1) Rabbit Polyclonal Antibody TA346635 from OriGene Technologies | Biocompare.com

Supplier Images

Pyrophosphatase 1 (PPA1) Rabbit Polyclonal Antibody

WB Suggested Anti-PPA1 Antibody; Titration: 5.0 ug/ml; Positive Control: HepG2 Whole Cell

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Pyrophosphatase 1 (PPA1) Rabbit Polyclonal Antibody

OriGene Technologies' Pyrophosphatase 1 (PPA1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pyrophosphatase 1 (PPA1) Rabbit Polyclonal Antibody was generated using inorganic pyrophosphatase 1 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-PPA1 Antibody

Product Specs
ItemPyrophosphatase 1 (PPA1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA346635
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetPyrophosphatase 1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-PPA1 antibody: synthetic peptide directed towards the N terminal of human PPA1. Synthetic peptide located within the following region: PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT
NCBI Full Gene Nameinorganic pyrophosphatase 1
NCBI Gene AliasesIOPPP, PP1, PP, SID6-8061, HEL-S-66p
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!