GUCY1B1 Rabbit Polyclonal Antibody TA338967 from OriGene Technologies | Biocompare.com

Supplier Images

GUCY1B1 Rabbit Polyclonal Antibody

WB Suggested Anti-GUCY1B3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 293T cell lysate.GUCY1B3 is supported by BioGPS gene expression data to be expressed in HEK293T

Be the first to write a review!

Supplier Page from
OriGene Technologies for
GUCY1B1 Rabbit Polyclonal Antibody

The GUCY1B1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to GUCY1B1. This antibody recognizes Homo Sapiens, and Human antigen. The GUCY1B1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-GUCY1B3 Antibody

Product Specs
ItemGUCY1B1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338967
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetGUCY1B1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-GUCY1B3 antibody: synthetic peptide directed towards the N terminal of human GUCY1B3. Synthetic peptide located within the following region: LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV
NCBI Full Gene Nameguanylate cyclase 1 soluble subunit beta 1
NCBI Gene AliasesGC-S-beta-1, GUC1B3, GUCSB3, GUCB3, GUCY1B3, GC-SB3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!