FAM120C Rabbit Polyclonal Antibody TA343049 from OriGene Technologies | Biocompare.com

Supplier Images

FAM120C Rabbit Polyclonal Antibody

WB Suggested Anti-FAM120¬∞C Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell
FAM120C Rabbit Polyclonal Antibody

FAM120C Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FAM120C Rabbit Polyclonal Antibody

OriGene Technologies' FAM120C Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody.

Description

Rabbit Polyclonal Anti-FAM120C Antibody

Product Specs
ItemFAM120C Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA343049
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityHuman
TargetFAM120C
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-FAM120? antibody: synthetic peptide directed towards the N terminal of human FAM120?. Synthetic peptide located within the following region: IKAVSEYVSSIKDPSNLDVVGKDVFKQSQSRTEDKIERFKKAVEYYSVTT
NCBI Full Gene Namefamily with sequence similarity 120C
NCBI Gene AliasesCXorf17, ORF34
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!