Pyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody TA346312 from OriGene Technologies | Biocompare.com

Supplier Images

Pyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody

WB Suggested Anti-DLAT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate.DLAT is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Pyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody

OriGene Technologies' Pyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-DLAT Antibody

Product Specs
ItemPyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346312
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetPyruvate Dehydrogenase E2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DLAT antibody: synthetic peptide directed towards the C terminal of human DLAT. Synthetic peptide located within the following region: DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA
NCBI Full Gene Namedihydrolipoamide S-acetyltransferase
NCBI Gene AliasesDLTA, PDC-E2, E2, PBC, PDCE2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!