TEKT4 Rabbit Polyclonal Antibody TA340359 from OriGene Technologies | Biocompare.com

Supplier Images

TEKT4 Rabbit Polyclonal Antibody

WB Suggested Anti-TEKT4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
TEKT4 Rabbit Polyclonal Antibody

OriGene Technologies' TEKT4 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The TEKT4 Rabbit Polyclonal Antibody was generated using Tektin 4 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-TEKT4 Antibody

Product Specs
ItemTEKT4 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340359
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetTEKT4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-TEKT4 antibody: synthetic peptide directed towards the N terminal of human TEKT4. Synthetic peptide located within the following region: LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA
NCBI Full Gene Nametektin 4
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!