PTOV1 Rabbit Polyclonal Antibody TA339725 from OriGene Technologies | Biocompare.com

Supplier Images

PTOV1 Rabbit Polyclonal Antibody

WB Suggested Anti-PTOV1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysatePTOV1 is supported by BioGPS gene expression data to be expressed in Jurkat
PTOV1 Rabbit Polyclonal Antibody

Rabbit Anti-PTOV1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes and processes of intersticial cells; Primary Antibody Concentration: 1: 100;

Be the first to write a review!

Supplier Page from
OriGene Technologies for
PTOV1 Rabbit Polyclonal Antibody

The PTOV1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to PTOV1, and PTOV1 extended AT-hook containing adaptor protein. This antibody recognizes Homo Sapiens, and Human antigen. The PTOV1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-PTOV1 Antibody

Product Specs
ItemPTOV1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339725
Quantity100 µl
ApplicationsIHC, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetPTOV1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-PTOV1 antibody: synthetic peptide directed towards the N terminal of human PTOV1. Synthetic peptide located within the following region: DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN
NCBI Full Gene NamePTOV1 extended AT-hook containing adaptor protein
NCBI Gene AliasesACID2, PTOV-1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!