AZIN2 Rabbit Polyclonal Antibody TA340227 from OriGene Technologies | Biocompare.com

Supplier Images

AZIN2 Rabbit Polyclonal Antibody

WB Suggested Anti-ADC Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: COLO205 cell lysate
AZIN2 Rabbit Polyclonal Antibody

Sample Type: Human and Rat Cerebral CortexPrimary Dilution: 1: 3000

Be the first to write a review!

Supplier Page from
OriGene Technologies for
AZIN2 Rabbit Polyclonal Antibody

The AZIN2 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, Human, and Rat antigen. The AZIN2 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-ADC Antibody

Product Specs
ItemAZIN2 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340227
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman, Rat
TargetAZIN2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-ADC antibody: synthetic peptide directed towards the middle region of human ADC. Synthetic peptide located within the following region: RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH
NCBI Full Gene Nameantizyme inhibitor 2
NCBI Gene AliasesODC1L, AZI2, ADC, AZIB1, ODC-p, ODCp
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!