CSN3 Rabbit Polyclonal Antibody TA340060 from OriGene Technologies | Biocompare.com

Supplier Images

CSN3 Rabbit Polyclonal Antibody

WB Suggested Anti-CSN3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
CSN3 Rabbit Polyclonal Antibody

The CSN3 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to casein kappa, and CSN3. This antibody recognizes Homo Sapiens, and Human antigen. The CSN3 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-CSN3 Antibody

Product Specs
ItemCSN3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340060
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
PurityAffinity Purified
ReactivityHuman
TargetCSN3
IsotypeIgG
HostRabbit
TypePrimary Antibodies
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-CSN3 antibody: synthetic peptide directed towards the N terminal of human CSN3. Synthetic peptide located within the following region: MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYY
NCBI Full Gene Namecasein kappa
NCBI Gene AliasesCNS10, KCA, CSN10, CSNK
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!