LZTFL1 Rabbit Polyclonal Antibody TA346633 from OriGene Technologies | Biocompare.com

Supplier Images

LZTFL1 Rabbit Polyclonal Antibody

WB Suggested Anti-LZTFL1 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysateLZTFL1 is supported by BioGPS gene expression data to be expressed in Jurkat

Be the first to write a review!

Supplier Page from
OriGene Technologies for
LZTFL1 Rabbit Polyclonal Antibody

The LZTFL1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The LZTFL1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-LZTFL1 Antibody

Product Specs
ItemLZTFL1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA346633
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetLZTFL1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-LZTFL1 antibody: synthetic peptide directed towards the C terminal of human LZTFL1. Synthetic peptide located within the following region: VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
NCBI Full Gene Nameleucine zipper transcription factor like 1
NCBI Gene AliasesBBS17
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!